SEMA7A polyclonal antibody
  • SEMA7A polyclonal antibody

SEMA7A polyclonal antibody

Ref: AB-PAB31251
SEMA7A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SEMA7A.
Información adicional
Size 100 uL
Gene Name SEMA7A
Gene Alias CD108|CDw108|H-SEMA-K1|H-Sema-L|JMH|MGC126692|MGC126696|SEMAK1|SEMAL
Gene Description semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SEMA7A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8482
Iso type IgG

Enviar uma mensagem


SEMA7A polyclonal antibody

SEMA7A polyclonal antibody