CASP5 polyclonal antibody
  • CASP5 polyclonal antibody

CASP5 polyclonal antibody

Ref: AB-PAB31235
CASP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CASP5.
Información adicional
Size 100 uL
Gene Name CASP5
Gene Alias ICE(rel)III|ICEREL-III|ICH-3|MGC141966
Gene Description caspase 5, apoptosis-related cysteine peptidase
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CASP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 838
Iso type IgG

Enviar uma mensagem


CASP5 polyclonal antibody

CASP5 polyclonal antibody