CX3CL1 polyclonal antibody
  • CX3CL1 polyclonal antibody

CX3CL1 polyclonal antibody

Ref: AB-PAB31233
CX3CL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CX3CL1.
Información adicional
Size 100 uL
Gene Name CX3CL1
Gene Alias ABCD-3|C3Xkine|CXC3|CXC3C|NTN|NTT|SCYD1|fractalkine|neurotactin
Gene Description chemokine (C-X3-C motif) ligand 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CX3CL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6376
Iso type IgG

Enviar uma mensagem


CX3CL1 polyclonal antibody

CX3CL1 polyclonal antibody