MARK2 polyclonal antibody
  • MARK2 polyclonal antibody

MARK2 polyclonal antibody

Ref: AB-PAB31221
MARK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MARK2.
Información adicional
Size 100 uL
Gene Name MARK2
Gene Alias EMK1|MGC99619|PAR-1|Par1b
Gene Description MAP/microtubule affinity-regulating kinase 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MARK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2011
Iso type IgG

Enviar uma mensagem


MARK2 polyclonal antibody

MARK2 polyclonal antibody