UNC93B1 polyclonal antibody
  • UNC93B1 polyclonal antibody

UNC93B1 polyclonal antibody

Ref: AB-PAB31218
UNC93B1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human UNC93B1.
Información adicional
Size 100 uL
Gene Name UNC93B1
Gene Alias MGC126617|UNC93|UNC93B
Gene Description unc-93 homolog B1 (C. elegans)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLPRSGN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UNC93B1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 81622
Iso type IgG

Enviar uma mensagem


UNC93B1 polyclonal antibody

UNC93B1 polyclonal antibody