CPNE8 polyclonal antibody
  • CPNE8 polyclonal antibody

CPNE8 polyclonal antibody

Ref: AB-PAB31217
CPNE8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CPNE8.
Información adicional
Size 100 uL
Gene Name CPNE8
Gene Alias MGC129645|MGC129646
Gene Description copine VIII
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CPNE8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 144402
Iso type IgG

Enviar uma mensagem


CPNE8 polyclonal antibody

CPNE8 polyclonal antibody