CHRD polyclonal antibody
  • CHRD polyclonal antibody

CHRD polyclonal antibody

Ref: AB-PAB31194
CHRD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CHRD.
Información adicional
Size 100 uL
Gene Name CHRD
Gene Alias MGC133038
Gene Description chordin
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRDLPGLPRSRDPGEGCYFDGDRSW
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CHRD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8646
Iso type IgG

Enviar uma mensagem


CHRD polyclonal antibody

CHRD polyclonal antibody