MRPS18A polyclonal antibody
  • MRPS18A polyclonal antibody

MRPS18A polyclonal antibody

Ref: AB-PAB31192
MRPS18A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MRPS18A.
Información adicional
Size 100 uL
Gene Name MRPS18A
Gene Alias FLJ10548|HumanS18b|MRP-S18-3|MRPS18-3|S18bmt
Gene Description mitochondrial ribosomal protein S18A
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGRRPWGPRGAEGCRHSLPTQLPHVSAPPGRKVDIRSVNYTHHPMPTFPLPWAFPL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MRPS18A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55168
Iso type IgG

Enviar uma mensagem


MRPS18A polyclonal antibody

MRPS18A polyclonal antibody