CD99 polyclonal antibody
  • CD99 polyclonal antibody

CD99 polyclonal antibody

Ref: AB-PAB31189
CD99 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD99.
Información adicional
Size 100 uL
Gene Name CD99
Gene Alias MIC2|MIC2X|MIC2Y
Gene Description CD99 molecule
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CD99.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4267
Iso type IgG

Enviar uma mensagem


CD99 polyclonal antibody

CD99 polyclonal antibody