STK19 polyclonal antibody
  • STK19 polyclonal antibody

STK19 polyclonal antibody

Ref: AB-PAB31173
STK19 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human STK19.
Información adicional
Size 100 uL
Gene Name STK19
Gene Alias D6S60|D6S60E|G11|HLA-RP1|MGC117388|RP1
Gene Description serine/threonine kinase 19
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human STK19.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8859
Iso type IgG

Enviar uma mensagem


STK19 polyclonal antibody

STK19 polyclonal antibody