HSF2 polyclonal antibody
  • HSF2 polyclonal antibody

HSF2 polyclonal antibody

Ref: AB-PAB31171
HSF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human HSF2.
Información adicional
Size 100 uL
Gene Name HSF2
Gene Alias MGC117376|MGC156196|MGC75048
Gene Description heat shock transcription factor 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HSF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3298
Iso type IgG

Enviar uma mensagem


HSF2 polyclonal antibody

HSF2 polyclonal antibody