DLGAP2 polyclonal antibody
  • DLGAP2 polyclonal antibody

DLGAP2 polyclonal antibody

Ref: AB-PAB31151
DLGAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DLGAP2.
Información adicional
Size 100 uL
Gene Name DLGAP2
Gene Alias DAP2|SAPAP2
Gene Description discs, large (Drosophila) homolog-associated protein 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HSKRSKSKERKPEGKPRPGMSSWWSSDDNLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKCSACEGLALTPDAKYLKRSSWST
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DLGAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9228
Iso type IgG

Enviar uma mensagem


DLGAP2 polyclonal antibody

DLGAP2 polyclonal antibody