DACT2 polyclonal antibody
  • DACT2 polyclonal antibody

DACT2 polyclonal antibody

Ref: AB-PAB31148
DACT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DACT2.
Información adicional
Size 100 uL
Gene Name DACT2
Gene Alias C6orf116|DAPPER2|DPR2|FLJ31232|MGC133141|MGC133142|RP11-503C24.7|bA503C24.7
Gene Description dapper, antagonist of beta-catenin, homolog 2 (Xenopus laevis)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PWGTFWPRPVSTGDLDRALPADTGLQKASADAELLGLLCQGVDIPLHVPDPKYRQDLVSQGGREVYPYPSPLHAVALQSPLFVLTKETPQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DACT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 168002
Iso type IgG

Enviar uma mensagem


DACT2 polyclonal antibody

DACT2 polyclonal antibody