SLC22A7 polyclonal antibody
  • SLC22A7 polyclonal antibody

SLC22A7 polyclonal antibody

Ref: AB-PAB31147
SLC22A7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SLC22A7.
Información adicional
Size 100 uL
Gene Name SLC22A7
Gene Alias MGC24091|MGC45202|NLT|OAT2
Gene Description solute carrier family 22 (organic anion transporter), member 7
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QAQLPETIQDVERKSAPTSLQEEEMPMKQVQN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SLC22A7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10864
Iso type IgG

Enviar uma mensagem


SLC22A7 polyclonal antibody

SLC22A7 polyclonal antibody