MLLT4 polyclonal antibody
  • MLLT4 polyclonal antibody

MLLT4 polyclonal antibody

Ref: AB-PAB31146
MLLT4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MLLT4.
Información adicional
Size 100 uL
Gene Name MLLT4
Gene Alias AF-6|AF6|AFADIN|FLJ34371|RP3-431P23.3
Gene Description myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MLLT4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4301
Iso type IgG

Enviar uma mensagem


MLLT4 polyclonal antibody

MLLT4 polyclonal antibody