PKIB polyclonal antibody
  • PKIB polyclonal antibody

PKIB polyclonal antibody

Ref: AB-PAB31144
PKIB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PKIB.
Información adicional
Size 100 uL
Gene Name PKIB
Gene Alias FLJ23817|PRKACN2
Gene Description protein kinase (cAMP-dependent, catalytic) inhibitor beta
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MHILFVDVAMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PKIB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5570
Iso type IgG

Enviar uma mensagem


PKIB polyclonal antibody

PKIB polyclonal antibody