CAMP polyclonal antibody
  • CAMP polyclonal antibody

CAMP polyclonal antibody

Ref: AB-PAB31141
CAMP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CAMP.
Información adicional
Size 100 uL
Gene Name CAMP
Gene Alias CAP18|CRAMP|FALL-39|FALL39|HSD26|LL37
Gene Description cathelicidin antimicrobial peptide
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq RSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CAMP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 820
Iso type IgG

Enviar uma mensagem


CAMP polyclonal antibody

CAMP polyclonal antibody