ALPK2 polyclonal antibody
  • ALPK2 polyclonal antibody

ALPK2 polyclonal antibody

Ref: AB-PAB31139
ALPK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ALPK2.
Información adicional
Size 100 uL
Gene Name ALPK2
Gene Alias FLJ34875|FLJ43253|HAK
Gene Description alpha-kinase 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EEAPFTGTTTISFSNLGGVHKENASLAQHSEVKPCTCGPQHEEKQDRDGNIPDNFREDLKYEQSISEANDETMSPGVFSRHLPKDARAD
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ALPK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 115701
Iso type IgG

Enviar uma mensagem


ALPK2 polyclonal antibody

ALPK2 polyclonal antibody