GPRC5C polyclonal antibody
  • GPRC5C polyclonal antibody

GPRC5C polyclonal antibody

Ref: AB-PAB31138
GPRC5C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GPRC5C.
Información adicional
Size 100 uL
Gene Name GPRC5C
Gene Alias MGC131820|RAIG-3|RAIG3
Gene Description G protein-coupled receptor, family C, group 5, member C
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GPRC5C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55890
Iso type IgG

Enviar uma mensagem


GPRC5C polyclonal antibody

GPRC5C polyclonal antibody