PRKACB polyclonal antibody
  • PRKACB polyclonal antibody

PRKACB polyclonal antibody

Ref: AB-PAB31137
PRKACB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PRKACB.
Información adicional
Size 100 uL
Gene Name PRKACB
Gene Alias DKFZp781I2452|MGC41879|MGC9320|PKACB
Gene Description protein kinase, cAMP-dependent, catalytic, beta
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWDRSMKEFLAKAKEDFLKKWENPTQNNAGLEDFER
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PRKACB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5567
Iso type IgG

Enviar uma mensagem


PRKACB polyclonal antibody

PRKACB polyclonal antibody