LTB4R2 polyclonal antibody
  • LTB4R2 polyclonal antibody

LTB4R2 polyclonal antibody

Ref: AB-PAB31136
LTB4R2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LTB4R2.
Información adicional
Size 100 uL
Gene Name LTB4R2
Gene Alias BLT2|BLTR2|JULF2|KPG_004|NOP9
Gene Description leukotriene B4 receptor 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human LTB4R2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 56413
Iso type IgG

Enviar uma mensagem


LTB4R2 polyclonal antibody

LTB4R2 polyclonal antibody