KIF2A polyclonal antibody
  • KIF2A polyclonal antibody

KIF2A polyclonal antibody

Ref: AB-PAB31125
KIF2A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human KIF2A.
Información adicional
Size 100 uL
Gene Name KIF2A
Gene Alias HK2|KIF2
Gene Description kinesin heavy chain member 2A
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq DNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 35-144 of human KIF2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3796
Iso type IgG

Enviar uma mensagem


KIF2A polyclonal antibody

KIF2A polyclonal antibody