AFG3L2 polyclonal antibody
  • AFG3L2 polyclonal antibody

AFG3L2 polyclonal antibody

Ref: AB-PAB31122
AFG3L2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human AFG3L2.
Información adicional
Size 100 uL
Gene Name AFG3L2
Gene Alias FLJ25993
Gene Description AFG3 ATPase family gene 3-like 2 (yeast)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 503-649 of human AFG3L2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10939
Iso type IgG

Enviar uma mensagem


AFG3L2 polyclonal antibody

AFG3L2 polyclonal antibody