CAPN10 polyclonal antibody
  • CAPN10 polyclonal antibody

CAPN10 polyclonal antibody

Ref: AB-PAB31110
CAPN10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CAPN10.
Información adicional
Size 100 uL
Gene Name CAPN10
Gene Alias -
Gene Description calpain 10
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGGQQDRPGRWEHRTCRQLLHLKDQCLISCCVLSPRAGARELGEFHAFIVSDL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 146-245 of human CAPN10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 11132
Iso type IgG

Enviar uma mensagem


CAPN10 polyclonal antibody

CAPN10 polyclonal antibody