LAMB1 polyclonal antibody
  • LAMB1 polyclonal antibody

LAMB1 polyclonal antibody

Ref: AB-PAB31109
LAMB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LAMB1.
Información adicional
Size 100 uL
Gene Name LAMB1
Gene Alias CLM|MGC142015
Gene Description laminin, beta 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq NQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 652-790 of human LAMB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3912
Iso type IgG

Enviar uma mensagem


LAMB1 polyclonal antibody

LAMB1 polyclonal antibody