FZD7 polyclonal antibody
  • FZD7 polyclonal antibody

FZD7 polyclonal antibody

Ref: AB-PAB31107
FZD7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FZD7.
Información adicional
Size 100 uL
Gene Name FZD7
Gene Alias FzE3
Gene Description frizzled homolog 7 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IF
Immunogen Prot. Seq CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FZD7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8324
Iso type IgG

Enviar uma mensagem


FZD7 polyclonal antibody

FZD7 polyclonal antibody