FGF11 polyclonal antibody
  • FGF11 polyclonal antibody

FGF11 polyclonal antibody

Ref: AB-PAB31106
FGF11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FGF11.
Información adicional
Size 100 uL
Gene Name FGF11
Gene Alias FHF3|FLJ16061|MGC102953|MGC45269
Gene Description fibroblast growth factor 11
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IF
Immunogen Prot. Seq VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FGF11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2256
Iso type IgG

Enviar uma mensagem


FGF11 polyclonal antibody

FGF11 polyclonal antibody