DVL3 polyclonal antibody
  • DVL3 polyclonal antibody

DVL3 polyclonal antibody

Ref: AB-PAB31104
DVL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DVL3.
Información adicional
Size 100 uL
Gene Name DVL3
Gene Alias KIAA0208
Gene Description dishevelled, dsh homolog 3 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq SFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DVL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1857
Iso type IgG

Enviar uma mensagem


DVL3 polyclonal antibody

DVL3 polyclonal antibody