FZD5 polyclonal antibody
  • FZD5 polyclonal antibody

FZD5 polyclonal antibody

Ref: AB-PAB31100
FZD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FZD5.
Información adicional
Size 100 uL
Gene Name FZD5
Gene Alias C2orf31|DKFZp434E2135|HFZ5|MGC129692
Gene Description frizzled homolog 5 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FZD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7855
Iso type IgG

Enviar uma mensagem


FZD5 polyclonal antibody

FZD5 polyclonal antibody