PIK3CD polyclonal antibody
  • PIK3CD polyclonal antibody

PIK3CD polyclonal antibody

Ref: AB-PAB31097
PIK3CD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PIK3CD.
Información adicional
Size 100 uL
Gene Name PIK3CD
Gene Alias p110D
Gene Description phosphoinositide-3-kinase, catalytic, delta polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PIK3CD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5293
Iso type IgG

Enviar uma mensagem


PIK3CD polyclonal antibody

PIK3CD polyclonal antibody