GRB2 polyclonal antibody
  • GRB2 polyclonal antibody

GRB2 polyclonal antibody

Ref: AB-PAB31095
GRB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GRB2.
Información adicional
Size 100 uL
Gene Name GRB2
Gene Alias ASH|EGFRBP-GRB2|Grb3-3|MST084|MSTP084
Gene Description growth factor receptor-bound protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IF
Immunogen Prot. Seq KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
Form Liquid
Recomended Dilution Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GRB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2885
Iso type IgG

Enviar uma mensagem


GRB2 polyclonal antibody

GRB2 polyclonal antibody