DVL2 polyclonal antibody
  • DVL2 polyclonal antibody

DVL2 polyclonal antibody

Ref: AB-PAB31094
DVL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DVL2.
Información adicional
Size 100 uL
Gene Name DVL2
Gene Alias -
Gene Description dishevelled, dsh homolog 2 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq PNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVP
Form Liquid
Recomended Dilution Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DVL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1856
Iso type IgG

Enviar uma mensagem


DVL2 polyclonal antibody

DVL2 polyclonal antibody