FZD6 polyclonal antibody
  • FZD6 polyclonal antibody

FZD6 polyclonal antibody

Ref: AB-PAB31093
FZD6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FZD6.
Información adicional
Size 100 uL
Gene Name FZD6
Gene Alias Hfz6
Gene Description frizzled homolog 6 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FZD6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8323
Iso type IgG

Enviar uma mensagem


FZD6 polyclonal antibody

FZD6 polyclonal antibody