CDK4 polyclonal antibody
  • CDK4 polyclonal antibody

CDK4 polyclonal antibody

Ref: AB-PAB31092
CDK4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CDK4.
Información adicional
Size 100 uL
Gene Name CDK4
Gene Alias CMM3|MGC14458|PSK-J3
Gene Description cyclin-dependent kinase 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IF
Immunogen Prot. Seq KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CDK4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1019
Iso type IgG

Enviar uma mensagem


CDK4 polyclonal antibody

CDK4 polyclonal antibody