CDKN1A polyclonal antibody
  • CDKN1A polyclonal antibody

CDKN1A polyclonal antibody

Ref: AB-PAB31089
CDKN1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CDKN1A.
Información adicional
Size 100 uL
Gene Name CDKN1A
Gene Alias CAP20|CDKN1|CIP1|MDA-6|P21|SDI1|WAF1|p21CIP1
Gene Description cyclin-dependent kinase inhibitor 1A (p21, Cip1)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IF
Immunogen Prot. Seq ARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKR
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CDKN1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1026
Iso type IgG

Enviar uma mensagem


CDKN1A polyclonal antibody

CDKN1A polyclonal antibody