MUC4 polyclonal antibody
  • MUC4 polyclonal antibody

MUC4 polyclonal antibody

Ref: AB-PAB31087
MUC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MUC4.
Información adicional
Size 100 uL
Gene Name MUC4
Gene Alias HSA276359
Gene Description mucin 4, cell surface associated
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IQYTSNAEDANFTLRDSCTDLELFENGTLLWTPKSLEPFTLEILARSAKIGLASALQPRTVVCHCNAESQCLYNQTSRVGNSSLEVAGCKCDGGTFGRYCEGSEDACEEPCFPSVHCVPGKGCEACPPNLTGD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MUC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4585
Iso type IgG

Enviar uma mensagem


MUC4 polyclonal antibody

MUC4 polyclonal antibody