EXDL2 polyclonal antibody
  • EXDL2 polyclonal antibody

EXDL2 polyclonal antibody

Ref: AB-PAB31086
EXDL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human EXDL2.
Información adicional
Size 100 uL
Gene Name EXDL2
Gene Alias C14orf114|DKFZp781A0133|DKFZp781L15100|FLJ10738
Gene Description exonuclease 3'-5' domain-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq TSCHAISNYYDNHLKQQLAKEFQAPIGSEEGLRLLEDPERRQVRSGARALLNAESLPTQRKEELLQALREFYNTDVVTEEMLQEAASLETRISNENYVPHGLKVVQCH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human EXDL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55218
Iso type IgG

Enviar uma mensagem


EXDL2 polyclonal antibody

EXDL2 polyclonal antibody