CACNG4 polyclonal antibody
  • CACNG4 polyclonal antibody

CACNG4 polyclonal antibody

Ref: AB-PAB31084
CACNG4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CACNG4.
Información adicional
Size 100 uL
Gene Name CACNG4
Gene Alias MGC11138|MGC24983
Gene Description calcium channel, voltage-dependent, gamma subunit 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CACNG4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 27092
Iso type IgG

Enviar uma mensagem


CACNG4 polyclonal antibody

CACNG4 polyclonal antibody