CAND2 polyclonal antibody
  • CAND2 polyclonal antibody

CAND2 polyclonal antibody

Ref: AB-PAB31082
CAND2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CAND2.
Información adicional
Size 100 uL
Gene Name CAND2
Gene Alias KIAA0667|TIP120B|Tp120b
Gene Description cullin-associated and neddylation-dissociated 2 (putative)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MPVLVSGIIFSLADRSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYKIAAEALVVLQELVRALWPLHRPRMLDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CAND2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23066
Iso type IgG

Enviar uma mensagem


CAND2 polyclonal antibody

CAND2 polyclonal antibody