DLX5 polyclonal antibody
  • DLX5 polyclonal antibody

DLX5 polyclonal antibody

Ref: AB-PAB31076
DLX5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DLX5.
Información adicional
Size 100 uL
Gene Name DLX5
Gene Alias -
Gene Description distal-less homeobox 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Western Blot (1:500-1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DLX5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1749
Iso type IgG

Enviar uma mensagem


DLX5 polyclonal antibody

DLX5 polyclonal antibody