UBAC1 polyclonal antibody
  • UBAC1 polyclonal antibody

UBAC1 polyclonal antibody

Ref: AB-PAB31075
UBAC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human UBAC1.
Información adicional
Size 100 uL
Gene Name UBAC1
Gene Alias GBDR1|RP11-432J22.3|UBADC1
Gene Description UBA domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq MEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UBAC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10422
Iso type IgG

Enviar uma mensagem


UBAC1 polyclonal antibody

UBAC1 polyclonal antibody