NDUFB5 polyclonal antibody
  • NDUFB5 polyclonal antibody

NDUFB5 polyclonal antibody

Ref: AB-PAB31074
NDUFB5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NDUFB5.
Información adicional
Size 100 uL
Gene Name NDUFB5
Gene Alias CI-SGDH|DKFZp686N02262|FLJ30597|MGC111204|MGC12314|SGDH
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NDUFB5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4711
Iso type IgG

Enviar uma mensagem


NDUFB5 polyclonal antibody

NDUFB5 polyclonal antibody