FRMD8 polyclonal antibody
  • FRMD8 polyclonal antibody

FRMD8 polyclonal antibody

Ref: AB-PAB31072
FRMD8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FRMD8.
Información adicional
Size 100 uL
Gene Name FRMD8
Gene Alias FKSG44|FLJ32216|FLJ90369|MGC31785
Gene Description FERM domain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IF
Immunogen Prot. Seq SREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVED
Form Liquid
Recomended Dilution Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FRMD8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 83786
Iso type IgG

Enviar uma mensagem


FRMD8 polyclonal antibody

FRMD8 polyclonal antibody