RPS6KB2 polyclonal antibody
  • RPS6KB2 polyclonal antibody

RPS6KB2 polyclonal antibody

Ref: AB-PAB31063
RPS6KB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RPS6KB2.
Información adicional
Size 100 uL
Gene Name RPS6KB2
Gene Alias KLS|P70-beta|P70-beta-1|P70-beta-2|S6K-beta2|S6K2|SRK|STK14B|p70(S6K)-beta|p70S6Kb
Gene Description ribosomal protein S6 kinase, 70kDa, polypeptide 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RPS6KB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6199
Iso type IgG

Enviar uma mensagem


RPS6KB2 polyclonal antibody

RPS6KB2 polyclonal antibody