DCC polyclonal antibody
  • DCC polyclonal antibody

DCC polyclonal antibody

Ref: AB-PAB31060
DCC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DCC.
Información adicional
Size 100 uL
Gene Name DCC
Gene Alias CRC18|CRCR1|IGDCC1
Gene Description deleted in colorectal carcinoma
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IF
Immunogen Prot. Seq GDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSN
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DCC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1630
Iso type IgG

Enviar uma mensagem


DCC polyclonal antibody

DCC polyclonal antibody