EML4 polyclonal antibody
  • EML4 polyclonal antibody

EML4 polyclonal antibody

Ref: AB-PAB31053
EML4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human EML4.
Información adicional
Size 100 uL
Gene Name EML4
Gene Alias C2orf2|DKFZp686P18118|ELP120|FLJ10942|FLJ32318|ROPP120
Gene Description echinoderm microtubule associated protein like 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq MSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEES
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-2500)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human EML4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 27436
Iso type IgG

Enviar uma mensagem


EML4 polyclonal antibody

EML4 polyclonal antibody