TNFRSF1A polyclonal antibody
  • TNFRSF1A polyclonal antibody

TNFRSF1A polyclonal antibody

Ref: AB-PAB31030
TNFRSF1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TNFRSF1A.
Información adicional
Size 100 uL
Gene Name TNFRSF1A
Gene Alias CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60
Gene Description tumor necrosis factor receptor superfamily, member 1A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TNFRSF1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7132
Iso type IgG

Enviar uma mensagem


TNFRSF1A polyclonal antibody

TNFRSF1A polyclonal antibody