CCDC134 polyclonal antibody
  • CCDC134 polyclonal antibody

CCDC134 polyclonal antibody

Ref: AB-PAB31024
CCDC134 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CCDC134.
Información adicional
Size 100 uL
Gene Name CCDC134
Gene Alias FLJ22349|MGC21013|dJ821D11.3
Gene Description coiled-coil domain containing 134
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQEL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CCDC134.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 79879
Iso type IgG

Enviar uma mensagem


CCDC134 polyclonal antibody

CCDC134 polyclonal antibody