MAMLD1 polyclonal antibody
  • MAMLD1 polyclonal antibody

MAMLD1 polyclonal antibody

Ref: AB-PAB31023
MAMLD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MAMLD1.
Información adicional
Size 100 uL
Gene Name MAMLD1
Gene Alias CG1|CXorf6|F18
Gene Description mastermind-like domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq KRPCLEDVTLAMGPGAHPSTACAELQVPPLTINPSPAAMGVAGQSLLLENNPMNGNIMGSPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELLEELTKIQDPSPNELDLE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MAMLD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10046
Iso type IgG

Enviar uma mensagem


MAMLD1 polyclonal antibody

MAMLD1 polyclonal antibody