UBE2D2 polyclonal antibody
  • UBE2D2 polyclonal antibody

UBE2D2 polyclonal antibody

Ref: AB-PAB31022
UBE2D2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human UBE2D2.
Información adicional
Size 100 uL
Gene Name UBE2D2
Gene Alias E2(17)KB2|PUBC1|UBC4|UBC4/5|UBCH5B
Gene Description ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Immunofluorescence (0.25-2 ug/mL)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UBE2D2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7322
Iso type IgG

Enviar uma mensagem


UBE2D2 polyclonal antibody

UBE2D2 polyclonal antibody